Structure of PDB 5eay Chain D Binding Site BS01

Receptor Information
>5eay Chain D (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLSEGAIAAIMQKGDTNIKPILQVINIRPITPPRYRLLMSDGLNTLSSFM
LATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEA
VGVKIGNPVPYN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5eay Dna2 nuclease-helicase structure, mechanism and regulation by Rpa.
Resolution1.55 Å
Binding residue
(original residue number in PDB)		N29 R31 R43 L45 S54 S55 M57 N85 L87 K88 R91
Binding residue
(residue number reindexed from 1)		N26 R28 R36 L38 S47 S48 M50 N78 L80 K81 R84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006260 DNA replication
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5eay, PDBe:5eay, PDBj:5eay
PDBsum5eay
PubMed26491943
UniProtP27694|RFA1_HUMAN Replication protein A 70 kDa DNA-binding subunit (Gene Name=RPA1)

[Back to BioLiP]