Structure of PDB 5e8i Chain D Binding Site BS01

Receptor Information
>5e8i Chain D (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKP
NMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5e8i Structural Basis for Dimerization and DNA Binding of Transcription Factor FLI1.
Resolution3.45 Å
Binding residue
(original residue number in PDB)		S294 T301 E303
Binding residue
(residue number reindexed from 1)		S16 T23 E25
Binding affinityPDBbind-CN: Kd=16nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5e8i, PDBe:5e8i, PDBj:5e8i
PDBsum5e8i
PubMed26618620
UniProtQ01543|FLI1_HUMAN Friend leukemia integration 1 transcription factor (Gene Name=FLI1)

[Back to BioLiP]