Structure of PDB 5dhm Chain D Binding Site BS01

Receptor Information
>5dhm Chain D (length=266) Species: 431947 (Porphyromonas gingivalis ATCC 33277) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RNQGSAAERLITNLYLLLFDQSGANPAKYYIASGGIWLPDDMKVKLDMTQ
SEAGERKVYVVANVDNAVKTALDAVANESDLQTVKRTTAMPWSTDIASPF
LMSGNKTHDFLANRLLDNVPLVRAIAKVELNISLSEKFQIVPIIVNGSLS
EFKFRYVNFDKETYVVKPTTKPDNLISSANGVWPQITDWTVWGASLNTSP
APDAGTGYTLDANGKVTALRIVTYLNERDSKGATVEVALPRGPELYRLPL
PDKILRNHWYKYEVEI
Ligand information
>5dhm Chain B (length=21) Species: 431947 (Porphyromonas gingivalis ATCC 33277) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RSIEISIRVDDFTKTGETVRY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5dhm Structure of the fimbrial protein Mfa4 from Porphyromonas gingivalis in its precursor form: implications for a donor-strand complementation mechanism.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		R53 N54 Q55 E60 W93 M98 K99 V100 L102 M104 T105 Q106 F166 R170 L171 L172 N174 V175 P176 L177 R179 Y313 R314 N324 H325 W326 K328 Y329 E330 V331 E332
Binding residue
(residue number reindexed from 1)		R1 N2 Q3 E8 W37 M42 K43 V44 L46 M48 T49 Q50 F110 R114 L115 L116 N118 V119 P120 L121 R123 Y246 R247 N257 H258 W259 K261 Y262 E263 V264 E265
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0009279 cell outer membrane
GO:0009289 pilus

View graph for
Cellular Component
External links
PDB RCSB:5dhm, PDBe:5dhm, PDBj:5dhm
PDBsum5dhm
PubMed26972441
UniProtB2RHG4|MFA4_PORG3 Minor fimbrium tip subunit MfA4 (Gene Name=PGN_0290)

[Back to BioLiP]