Structure of PDB 5ddr Chain D Binding Site BS01

Receptor Information
>5ddr Chain D (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQ
AFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Ligand information
>5ddr Chain A (length=61) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cguugacccaggaaacugggcggaaguaagguccauugcacuccgggccu
gaagcaacgcg
<<<<<.<<<<<....>>>>>........<<<<<<..........>>>>>>
....>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ddr Structural and Dynamic Basis for Low-Affinity, High-Selectivity Binding of L-Glutamine by the Glutamine Riboswitch.
Resolution2.605 Å
Binding residue
(original residue number in PDB)		Y12 N15 E18 K21 L43 S45 R46 S47 L48 K49 M50 R51 Q53 F55 K79 Q84 K87 T88 D89 S90 D91
Binding residue
(residue number reindexed from 1)		Y9 N12 E15 K18 L40 S42 R43 S44 L45 K46 M47 R48 Q50 F52 K76 Q81 K84 T85 D86 S87 D88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:5ddr, PDBe:5ddr, PDBj:5ddr
PDBsum5ddr
PubMed26655897
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]