Structure of PDB 5ddp Chain D Binding Site BS01

Receptor Information
>5ddp Chain D (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMR
GQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Ligand information
>5ddp Chain A (length=61) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cguugacccaggaaacugggcggaaguaagguccauugcacuccgggccu
gaagcaacgcg
<<<<<.<<<<<....>>>>>........<<<<<<..........>>>>>>
....>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ddp Structural and Dynamic Basis for Low-Affinity, High-Selectivity Binding of L-Glutamine by the Glutamine Riboswitch.
Resolution2.302 Å
Binding residue
(original residue number in PDB)		Y12 N14 N15 E18 K21 L43 R46 S47 L48 K49 M50 R51 Q53 F55 K79 Q84 A86 K87 D89 S90 D91
Binding residue
(residue number reindexed from 1)		Y11 N13 N14 E17 K20 L42 R45 S46 L47 K48 M49 R50 Q52 F54 K78 Q83 A85 K86 D88 S89 D90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:5ddp, PDBe:5ddp, PDBj:5ddp
PDBsum5ddp
PubMed26655897
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]