Structure of PDB 5d0j Chain D Binding Site BS01

Receptor Information
>5d0j Chain D (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AIHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCH
LQKVKHYLILPSEEERLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLR
HCCT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5d0j Unexpected involvement of staple leads to redesign of selective bicyclic peptide inhibitor of Grb7.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
R438 R462 N463 K478 H479 Y480 L481 M495
Binding residue
(residue number reindexed from 1)
R15 R39 N40 K55 H56 Y57 L58 M71
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5d0j, PDBe:5d0j, PDBj:5d0j
PDBsum5d0j
PubMed27257138
UniProtQ14451|GRB7_HUMAN Growth factor receptor-bound protein 7 (Gene Name=GRB7)

[Back to BioLiP]