Structure of PDB 5bs0 Chain D Binding Site BS01

Receptor Information
>5bs0 Chain D (length=197) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLYV
RPYQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVRPGGAGPF
FVVFGKGTKLSVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQ
SKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5bs0 Direct molecular mimicry enables off-target cardiovascular toxicity by an enhanced affinity TCR designed for cancer immunotherapy.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		Y32 A98
Binding residue
(residue number reindexed from 1)		Y31 A97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002250 adaptive immune response
GO:0009617 response to bacterium
Cellular Component
GO:0005886 plasma membrane
GO:0042101 T cell receptor complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5bs0, PDBe:5bs0, PDBj:5bs0
PDBsum5bs0
PubMed26758806
UniProtA0A0B4J279;
P01848|TRAC_HUMAN T cell receptor alpha chain constant (Gene Name=TRAC)

[Back to BioLiP]