Structure of PDB 5brm Chain D Binding Site BS01

Receptor Information
>5brm Chain D (length=144) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWKCSA
PKYIDYLMTWVQDQLDDETLFPFPKNFMSVAKTILKRLFRVYAHIYHQHF
DSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5brm Structural basis for Mob1-dependent activation of the core Mst-Lats kinase cascade in Hippo signaling.
Resolution2.651 Å
Binding residue
(original residue number in PDB)
R92 Y93 E94 Y95 H96 R157 Y163 F167 M171 E176 R199 E200 E206 L207
Binding residue
(residue number reindexed from 1)
R41 Y42 E43 Y44 H45 R90 Y96 F100 M104 E109 R132 E133 E139 L140
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5brm, PDBe:5brm, PDBj:5brm
PDBsum5brm
PubMed26108669
UniProtQ9H8S9|MOB1A_HUMAN MOB kinase activator 1A (Gene Name=MOB1A)

[Back to BioLiP]