Structure of PDB 5bnh Chain D Binding Site BS01

Receptor Information
>5bnh Chain D (length=123) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSVDSVLFGSLRGHVVGLRYYTGVVNNNEMVALQRDPNNPYDKNAIKVNN
VNGNQVGHLKKELAGALAYIMDNKLAQIEGVVPFGANNAFTMPLHMTFWG
KEENRKAVSDQLKKHGFKLGPAP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5bnh Co-crystal structure of the HLTF HIRAN domain with a ssDNA fragment
Resolution1.7 Å
Binding residue
(original residue number in PDB)		R71 Y72 Y73 Y93 D94 H110 K112 K113
Binding residue
(residue number reindexed from 1)		R19 Y20 Y21 Y41 D42 H58 K60 K61
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
3.6.4.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides

View graph for
Molecular Function
External links
PDB RCSB:5bnh, PDBe:5bnh, PDBj:5bnh
PDBsum5bnh
PubMed
UniProtQ14527|HLTF_HUMAN Helicase-like transcription factor (Gene Name=HLTF)

[Back to BioLiP]