Structure of PDB 5af6 Chain D Binding Site BS01

Receptor Information
>5af6 Chain D (length=76) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQIFVKTLTGRTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQL
EDGRTLSDYNIQKESTLHLVLRLRGG
Ligand information
>5af6 Chain F (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIKWACEYCTYENWPSAIKCTMCRAQRP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5af6 Assembly and Specific Recognition of K29- and K33-Linked Polyubiquitin.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		I44 G47 V70 R72
Binding residue
(residue number reindexed from 1)		I44 G47 V70 R72
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5af6, PDBe:5af6, PDBj:5af6
PDBsum5af6
PubMed25752577
UniProtP0CG48|UBC_HUMAN Polyubiquitin-C (Gene Name=UBC)

[Back to BioLiP]