Structure of PDB 4zq0 Chain D Binding Site BS01

Receptor Information

>4zq0 Chain D (length=231) Species: 658858 (Giardia lamblia P15)

TREDYVFMAQLNENAERYDEMVETMRKISGMEGELSDKERNLLSVAYKNV
IGPRRAAWRIVSSIEAKEKGRQKPNAKRIEQIRVYRQKIEKELSDICNDI
LKLLQEQFVPRSTNADAKVFYYKMQGDYYRYLAEYSSGEDKEKIAGSALN
AYNSAFEISQQLPPTHPIRLGLALNFSVFYYEILASPDRACELARKAFDA
AITDLDKLTEESYKDSTLIMQLLRDNLNLWV

Ligand information

>4zq0 Chain H (length=4) Species: 32630 (synthetic construct)

ASAP

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4zq0 Molecular Dynamics Simulations and Structural Analysis of Giardia duodenalis 14-3-3 Protein-Protein Interactions.
• Resolution: 3.1 Å
• Binding residue (original residue number in PDB): K53 R60 R135 Y136 L179 N180 N231
• Binding residue (residue number reindexed from 1): K48 R55 R130 Y131 L174 N175 N226

Gene Ontology

Molecular Function

• GO:0003779 actin binding
• GO:0005515 protein binding
• GO:0019900 kinase binding
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0050815 phosphoserine residue binding
• GO:0051219 phosphoprotein binding

Biological Process

• GO:0000165 MAPK cascade
• GO:0007165 signal transduction
• GO:0008104 protein localization
• GO:0030010 establishment of cell polarity
• GO:0030036 actin cytoskeleton organization
• GO:0051289 protein homotetramerization
• GO:0051495 positive regulation of cytoskeleton organization
• GO:0070207 protein homotrimerization
• GO:0097298 regulation of nucleus size

Cellular Component

• GO:0005634 nucleus
• GO:0005635 nuclear envelope
• GO:0005737 cytoplasm
• GO:0005783 endoplasmic reticulum
• GO:0005819 spindle
• GO:0005856 cytoskeleton
• GO:0005930 axoneme
• GO:0031514 motile cilium

External links

• PDB: RCSB:4zq0, PDBe:4zq0, PDBj:4zq0
• PDBsum: 4zq0
• PubMed: 26551337
• UniProt: E2RU97|1433_GIAIC 14-3-3 protein (Gene Name=GL50803_006430)