Structure of PDB 4zq0 Chain D Binding Site BS01

Receptor Information
>4zq0 Chain D (length=231) Species: 658858 (Giardia lamblia P15) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TREDYVFMAQLNENAERYDEMVETMRKISGMEGELSDKERNLLSVAYKNV
IGPRRAAWRIVSSIEAKEKGRQKPNAKRIEQIRVYRQKIEKELSDICNDI
LKLLQEQFVPRSTNADAKVFYYKMQGDYYRYLAEYSSGEDKEKIAGSALN
AYNSAFEISQQLPPTHPIRLGLALNFSVFYYEILASPDRACELARKAFDA
AITDLDKLTEESYKDSTLIMQLLRDNLNLWV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4zq0 Molecular Dynamics Simulations and Structural Analysis of Giardia duodenalis 14-3-3 Protein-Protein Interactions.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
K53 R60 R135 Y136 L179 N180 N231
Binding residue
(residue number reindexed from 1)
K48 R55 R130 Y131 L174 N175 N226
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005515 protein binding
GO:0019900 kinase binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0050815 phosphoserine residue binding
GO:0051219 phosphoprotein binding
Biological Process
GO:0000165 MAPK cascade
GO:0007165 signal transduction
GO:0008104 protein localization
GO:0030010 establishment of cell polarity
GO:0030036 actin cytoskeleton organization
GO:0051289 protein homotetramerization
GO:0051495 positive regulation of cytoskeleton organization
GO:0070207 protein homotrimerization
GO:0097298 regulation of nucleus size
Cellular Component
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005819 spindle
GO:0005856 cytoskeleton
GO:0005930 axoneme
GO:0031514 motile cilium

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4zq0, PDBe:4zq0, PDBj:4zq0
PDBsum4zq0
PubMed26551337
UniProtE2RU97|1433_GIAIC 14-3-3 protein (Gene Name=GL50803_006430)

[Back to BioLiP]