Structure of PDB 4z7v Chain D Binding Site BS01

Receptor Information
>4z7v Chain D (length=175) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVT
PLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTI
SPSLLVCSVTDFYPAQIKVRWFQEETTGVVSTPLIRNGDWTFQILVMLEM
TPQRGDVYTCHVEHPSLQNPIIVEW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z7v Determinants of Gliadin-Specific T Cell Selection in Celiac Disease.
Resolution2.65 Å
Binding residue
(original residue number in PDB)		F11 G13 C15 L26 T28 Y30 Y37 Y47 A57 Y60 W61 R70 E74 V78 N82 L85
Binding residue
(residue number reindexed from 1)		F10 G12 C14 L25 T27 Y29 Y36 Y46 A56 Y59 W60 R69 E73 V77 N81 L84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4z7v, PDBe:4z7v, PDBj:4z7v
PDBsum4z7v
PubMed25948817
UniProtO19707

[Back to BioLiP]