Structure of PDB 4z2c Chain D Binding Site BS01

Receptor Information
>4z2c Chain D (length=194) Species: 1313 (Streptococcus pneumoniae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKSGLEIPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAILPI
RGKILNVEKASMDKILANEEIRSLFTAMGTGFGAEFDVSKARYQKLVLMT
DADVDGAHIRTLLLTLIYRYMKPILEAGYVYIAQPPLGEMDDHQLWETTM
DPEHRLMARVSVDDAAEADKIFDMLMGDRVEPRREFIEENAVYS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z2c Structural studies of the drug-stabilized cleavage complexes of topoisomerase IV and gyrase from Streptococcus pneumoniae
Resolution3.19 Å
Binding residue
(original residue number in PDB)
G457 K458 D510
Binding residue
(residue number reindexed from 1)
G52 K53 D105
Enzymatic activity
Catalytic site (original residue number in PDB) Y643
Catalytic site (residue number reindexed from 1) Y193
Enzyme Commision number 5.6.2.2: DNA topoisomerase (ATP-hydrolyzing).
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003918 DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
GO:0005524 ATP binding
Biological Process
GO:0006265 DNA topological change

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4z2c, PDBe:4z2c, PDBj:4z2c
PDBsum4z2c
PubMed
UniProtP0A4M0|GYRB_STRR6 DNA gyrase subunit B (Gene Name=gyrB)

[Back to BioLiP]