Structure of PDB 4y00 Chain D Binding Site BS01

Receptor Information
>4y00 Chain D (length=77) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRF
TEYETQVKVMSQRHMIGGRWCDCKLPN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4y00 Structural analysis of disease-related TDP-43 D169G mutation: linking enhanced stability and caspase cleavage efficiency to protein accumulation
Resolution3.0 Å
Binding residue
(original residue number in PDB)		S163 Q164
Binding residue
(residue number reindexed from 1)		S61 Q62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:4y00, PDBe:4y00, PDBj:4y00
PDBsum4y00
PubMed26883171
UniProtQ13148|TADBP_HUMAN TAR DNA-binding protein 43 (Gene Name=TARDBP)

[Back to BioLiP]