Structure of PDB 4xic Chain D Binding Site BS01

Receptor Information

>4xic Chain D (length=56) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRM
KWKKEN

Ligand information

>4xic Chain E (length=15) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agaaagccattagag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4xic Entropic Enhancement of Protein-DNA Affinity by Oxygen-to-Sulfur Substitution in DNA Phosphate.
Resolution	2.69 Å
Binding residue (original residue number in PDB)	R5 T7 Y25 R28 R31 Q50 R53 M54
Binding residue (residue number reindexed from 1)	R1 T3 Y21 R24 R27 Q46 R49 M50
Binding affinity	PDBbind-CN: Kd=2.9nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4xic, PDBe:4xic, PDBj:4xic
PDBsum	4xic
PubMed	26331260
UniProt	P02833\|ANTP_DROME Homeotic protein antennapedia (Gene Name=Antp)

[Back to BioLiP]