Structure of PDB 4xco Chain D Binding Site BS01

Receptor Information
>4xco Chain D (length=93) Species: 2190 (Methanocaldococcus jannaschii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DAIMRGKFTLNELMTQLEAIENMGSMKLTEAKIKKYKVIISSMTKEEREN
PKIIKASRIRRIARGSGTTENDVREVLRYYETTKNAIDKLRKG
Ligand information
>4xco Chain M (length=96) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcggugggggagcaucuccuguaggggagauguaacccccuuuaccugc
cgaaccccgccaggcccggaagggagcaacgguaggcaggacgucg
<<<<..<<<<<.<<<<<<<<<....>>>>>>>>>..>>>>>....<<<<<
<.....<<<...<.<<<....>>>..>..>>>..>>>>>>.>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xco Signal-sequence induced conformational changes in the signal recognition particle.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		V375 S378 S379 M380 T381 K382 S394 R395 R398 G402 S403 G404
Binding residue
(residue number reindexed from 1)		V38 S41 S42 M43 T44 K45 S57 R58 R61 G65 S66 G67
Enzymatic activity
Enzyme Commision number 3.6.5.4: signal-recognition-particle GTPase.
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005525 GTP binding
GO:0008312 7S RNA binding
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Cellular Component
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4xco, PDBe:4xco, PDBj:4xco
PDBsum4xco
PubMed26051119
UniProtQ57565|SRP54_METJA Signal recognition particle 54 kDa protein (Gene Name=srp54)

[Back to BioLiP]