Structure of PDB 4x4h Chain D Binding Site BS01

Receptor Information
>4x4h Chain D (length=76) Species: 211595 (Enterobacter sp. RFL1396) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIK
SLELIMKGLEVSDVVFFEMLIKEILK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4x4h Radiation damage to nucleoprotein complexes in macromolecular crystallography.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		T36 Y37 R46 N47 T49 S52
Binding residue
(residue number reindexed from 1)		T35 Y36 R45 N46 T48 S51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4x4h, PDBe:4x4h, PDBj:4x4h
PDBsum4x4h
PubMed25723923
UniProtQ8GGH0

[Back to BioLiP]