Structure of PDB 4x2v Chain D Binding Site BS01

Receptor Information

>4x2v Chain D (length=171) Species: 223997 (Murine norovirus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VSIWSRVVQFGTGWGFWVSGHVFITAKHVAPPKGTEIFGRKPGDFTVTSS
GDFLKYYFTSAVRPDIPAMVLENGCQEGVVASVLVKRASGEMLALAVRMG
SQAAIKIGSAVVHGQTGMLLTGSNAKAQDLGTIPGDAGCPYVYKKGNTWV
VIGVHVAATRSGNTVIAATHG

Ligand information

>4x2v Chain F (length=7) Species: 223997 (Murine norovirus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AAAAAAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4x2v Structure determination of Murine Norovirus NS6 proteases with C-terminal extensions designed to probe protease-substrate interactions.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	I107 I109
Binding residue (residue number reindexed from 1)	I105 I107

Enzymatic activity

Enzyme Commision number

2.7.7.48: RNA-directed RNA polymerase.
3.4.22.66: calicivirin.
3.6.1.15: nucleoside-triphosphate phosphatase.

Gene Ontology

	Molecular Function
GO:0004197	cysteine-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4x2v, PDBe:4x2v, PDBj:4x2v
PDBsum	4x2v
PubMed	25755927
UniProt	Q80J95\|POLG_MNV1 Genome polyprotein (Gene Name=ORF1)

[Back to BioLiP]