Structure of PDB 4wzs Chain D Binding Site BS01

Receptor Information
>4wzs Chain D (length=178) Species: 284813 (Encephalitozoon cuniculi GB-M1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGIIPTLQNVVATVNLSCKLDLKNIALRARNAEYNPKRFAAVIMRIREPK
TTALIFASGKMVITGAKSEKSSRMAAQRYAKIIHKLGFNATFDDFKIQNI
VSSCDIKFSIRLEGLAYAHSNYCSYEPELFPGLIYRMVKPKIVLLIFVSG
KIVLTGAKVRDDIYQAFNNIYPVLIQHR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wzs Structural basis for recognition and remodeling of the TBP:DNA:NC2 complex by Mot1.
Resolution3.78 Å
Binding residue
(original residue number in PDB)		Q26 N27 F57 R63 T70 T82 P149 F165 S167 K169
Binding residue
(residue number reindexed from 1)		Q8 N9 F39 R45 T52 T64 P131 F147 S149 K151
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0042802 identical protein binding
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006366 transcription by RNA polymerase II
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wzs, PDBe:4wzs, PDBj:4wzs
PDBsum4wzs
PubMed26258880
UniProtQ8ST28

[Back to BioLiP]