Structure of PDB 4wnn Chain D Binding Site BS01

Receptor Information
>4wnn Chain D (length=97) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKRSKARKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATE
ASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wnn FACT Disrupts Nucleosome Structure by Binding H2A-H2B with Conserved Peptide Motifs.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		S41 S42 Y45 I57 S58 Q59 K60 M62
Binding residue
(residue number reindexed from 1)		S12 S13 Y16 I28 S29 Q30 K31 M33
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4wnn, PDBe:4wnn, PDBj:4wnn
PDBsum4wnn
PubMed26455391
UniProtP02293|H2B1_YEAST Histone H2B.1 (Gene Name=HTB1)

[Back to BioLiP]