Structure of PDB 4wj7 Chain D Binding Site BS01

Receptor Information
>4wj7 Chain D (length=123) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IEKEVKYLGQLTSIPGYLNPSSRTEILHFIDNAKRAHQLPGHLTQEHDAV
LSLSAYNVKLAWRDGEDIILRVPIHDIAAVSYVRDDAAHLVVLKTAQACC
LVILAAESKVAAEELCCLLGQVF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wj7 Structural Basis for the Disruption of the Cerebral Cavernous Malformations 2 (CCM2) Interaction with Krev Interaction Trapped 1 (KRIT1) by Disease-associated Mutations.
Resolution2.753 Å
Binding residue
(original residue number in PDB)		P82 S83 S84 R85 H137 I139 A140 A141 V142 S143 Y144 R146 E207 F217
Binding residue
(residue number reindexed from 1)		P20 S21 S22 R23 H75 I77 A78 A79 V80 S81 Y82 R84 E113 F123
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4wj7, PDBe:4wj7, PDBj:4wj7
PDBsum4wj7
PubMed25525273
UniProtQ9BSQ5|CCM2_HUMAN Cerebral cavernous malformations 2 protein (Gene Name=CCM2)

[Back to BioLiP]