Structure of PDB 4uyj Chain D Binding Site BS01

Receptor Information
>4uyj Chain D (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVLLESEQFLTELTRLFQKCRTSGSVYITLKKYDGRTKPPADNKCLLRAT
DGKKKISTVVSSKEVNKFQMAYSNLLRANMDGL
Ligand information
>4uyj Chain S (length=110) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggggcuaggccgggggguucggcguccccuguaaccggaaaccgccgaua
ugccggggccgaagcccgaggggcgguucccguaaggguucccacccucg
ggcgugccuc
<<<<<..<<<<<<<<<<..(((((>>>>>>....<<<<....)))))...
..>>>>>>>>...<<<<<<<<<..<<..<<<....>>>..>>..>>>>>>
>>>..>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4uyj Crystal Structure of a Signal Recognition Particle Alu Domain in the Elongation Arrest Conformation.
Resolution3.35 Å
Binding residue
(original residue number in PDB)		M1 G24 S25 Y27 K31 Y33 R36 T37 K38 P39 L57 R59 K66
Binding residue
(residue number reindexed from 1)		M1 G24 S25 Y27 K31 Y33 R36 T37 K38 P39 L46 R48 K55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008312 7S RNA binding
GO:0030942 endoplasmic reticulum signal peptide binding
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Cellular Component
GO:0005786 signal recognition particle, endoplasmic reticulum targeting
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4uyj, PDBe:4uyj, PDBj:4uyj
PDBsum4uyj
PubMed25336584
UniProtP37108|SRP14_HUMAN Signal recognition particle 14 kDa protein (Gene Name=SRP14)

[Back to BioLiP]