Structure of PDB 4u7u Chain D Binding Site BS01

Receptor Information

>4u7u Chain D (length=191) Species: 83333 (Escherichia coli K-12)

AWMYLSKVIIARAWSRDLYQLHQGLWHLFPDFLFHVEKRNTPEGCHVLLQ
SAQMPVSTAVATVIKTKQVEFQLQVGVPLYFRLRANPIKTILDNQKRLDS
KGNIKRCRVPLIKEAEQIAWLQRKLGNAARVEDVHPISERPQYFSKSGKI
QTVCFEGVLTINDAPALIDLVQQGIGPAKSMGCGLLSLAPL

Ligand information

>4u7u Chain L (length=61)

auaaaccgggcucccugucgguuguaauugauaauguugagaguuccccg
cgccagcgggg

.............................................<<<<<
<....>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4u7u Crystal structure of the RNA-guided immune surveillance Cascade complex in Escherichia coli
• Resolution: 3.003 Å
• Binding residue (original residue number in PDB): K94 T95 I96 D98 N99 Q100 R102 R111 C112 R113 P115 I117 R128 K129 S155 K157 I158 Q159 K187 S188
• Binding residue (residue number reindexed from 1): K89 T90 I91 D93 N94 Q95 R97 R106 C107 R108 P110 I112 R123 K124 S147 K149 I150 Q151 K179 S180

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0004519 endonuclease activity
• GO:0004521 RNA endonuclease activity
• GO:0005515 protein binding

Biological Process

• GO:0006396 RNA processing
• GO:0051607 defense response to virus
• GO:0099048 CRISPR-cas system

Cellular Component

• GO:0032991 protein-containing complex

External links

• PDB: RCSB:4u7u, PDBe:4u7u, PDBj:4u7u
• PDBsum: 4u7u
• PubMed: 25118175
• UniProt: Q46897|CAS6_ECOLI CRISPR system Cascade subunit CasE (Gene Name=casE)