Structure of PDB 4u0b Chain D Binding Site BS01

Receptor Information

>4u0b Chain D (length=203) Species: 11698 (Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQ
DLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVQMREPRGSDIAGTT
STLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPK
EPFRDYVDRFYKTLRAEQTETLLVQNANPDCKTILKALGPGATLEEMMTA
CQG

Ligand information

>4u0b Chain P (length=14) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PVLFPGQPFGQPPL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4u0b Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	N53 L56 N57 M66 Q67 K70 N74 T107
Binding residue (residue number reindexed from 1)	N53 L56 N57 M66 Q67 K70 N74 T99

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0016032	viral process

View graph for
Biological Process

External links

PDB	RCSB:4u0b, PDBe:4u0b, PDBj:4u0b
PDBsum	4u0b
PubMed	25356722
UniProt	P12493\|GAG_HV1N5 Gag polyprotein (Gene Name=gag)

[Back to BioLiP]