Structure of PDB 4tzp Chain D Binding Site BS01

Receptor Information
>4tzp Chain D (length=81) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYDKVSQAKSIIIGTKQTVKALKRGSVKEVVVAKDADPILTSSVVSLAED
QGISVSMVESMKKLGKACGIEVGAAAVAIIL
Ligand information
>4tzp Chain F (length=102) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggugcgaugagaagaagaguauuaaggauuuacuaugauuagcgacucu
aggauagugaaagcuagaggauaguaaccuuaagaaggcacuucgagcac
cc
<<<<<<.....<<<<.......<<<<<<..<<<<<<<.........<<<<
<<...........>>>>>>.>>>>>>>>>>>>>.......>>>>..>>>>
>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tzp Dramatic Improvement of Crystals of Large RNAs by Cation Replacement and Dehydration.
Resolution8.503 Å
Binding residue
(original residue number in PDB)
K17 Q18 V20 K21 A22 L23 K24 R25 G26 S27
Binding residue
(residue number reindexed from 1)
K16 Q17 V19 K20 A21 L22 K23 R24 G25 S26
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:4tzp, PDBe:4tzp, PDBj:4tzp
PDBsum4tzp
PubMed25185828
UniProtP46350|RXL7_BACSU RNA-binding protein YbxF (Gene Name=rulS)

[Back to BioLiP]