Structure of PDB 4s2q Chain D Binding Site BS01

Receptor Information
>4s2q Chain D (length=76) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESEKR
PFVEEAERLRVQHKKDHPDYKYQPRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4s2q Crystal Structure of HMG domain of the chondrogenesis master regulator, Sox9 in complex with ChIP-Seq identified DNA element
Resolution2.7 Å
Binding residue
(original residue number in PDB)		R70 N73 F75 A96 S99 K100 W106 R107 K136 Y137
Binding residue
(residue number reindexed from 1)		R5 N8 F10 A31 S34 K35 W41 R42 K71 Y72
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4s2q, PDBe:4s2q, PDBj:4s2q
PDBsum4s2q
PubMed
UniProtQ04887|SOX9_MOUSE Transcription factor SOX-9 (Gene Name=Sox9)

[Back to BioLiP]