Structure of PDB 4rbo Chain D Binding Site BS01

Receptor Information
>4rbo Chain D (length=54) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMK
SKRW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4rbo Structure-based discovery of NANOG variant with enhanced properties to promote self-renewal and reprogramming of pluripotent stem cells.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		Y119 Y136 Q144 R147 M148 K151
Binding residue
(residue number reindexed from 1)		Y20 Y37 Q45 R48 M49 K52
Binding affinityPDBbind-CN: Kd=5.9uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4rbo, PDBe:4rbo, PDBj:4rbo
PDBsum4rbo
PubMed25825768
UniProtQ9H9S0|NANOG_HUMAN Homeobox protein NANOG (Gene Name=NANOG)

[Back to BioLiP]