Structure of PDB 4rb3 Chain D Binding Site BS01

Receptor Information
>4rb3 Chain D (length=133) Species: 1430440 (Magnetospirillum gryphiswaldense MSR-1 v2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSRIEQRLIDKGLKVTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRIS
IATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIE
FTSPEIEALQREIARKHGFRLVGHRLELYGVPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4rb3 Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		T17 Q19 R20 R49 S51 T54 R57
Binding residue
(residue number reindexed from 1)		T16 Q18 R19 R48 S50 T53 R56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:1900705 negative regulation of siderophore biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4rb3, PDBe:4rb3, PDBj:4rb3
PDBsum4rb3
PubMed26134419
UniProtV6F4Q0

[Back to BioLiP]