Structure of PDB 4qvd Chain D Binding Site BS01

Receptor Information

>4qvd Chain D (length=60) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVY
KHAISTVVPS

Ligand information

>4qvd Chain H (length=4) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uaaa

....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4qvd Structural insights into the recognition of the internal A-rich linker from OxyS sRNA by Escherichia coli Hfq
Resolution	1.972 Å
Binding residue (original residue number in PDB)	Y25 N28 G29 I30 K31 T61
Binding residue (residue number reindexed from 1)	Y20 N23 G24 I25 K26 T56
Binding affinity	PDBbind-CN: Kd=1490nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4qvd, PDBe:4qvd, PDBj:4qvd
PDBsum	4qvd
PubMed	25670676
UniProt	C1IFD2

[Back to BioLiP]