Structure of PDB 4qvc Chain D Binding Site BS01

Receptor Information
>4qvc Chain D (length=60) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVY
KHAISTVVPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qvc Structural insights into the recognition of the internal A-rich linker from OxyS sRNA by Escherichia coli Hfq
Resolution1.99 Å
Binding residue
(original residue number in PDB)		Y25 N28 G29 I30 K31
Binding residue
(residue number reindexed from 1)		Y20 N23 G24 I25 K26
Binding affinityPDBbind-CN: Kd=22nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4qvc, PDBe:4qvc, PDBj:4qvc
PDBsum4qvc
PubMed25670676
UniProtC1IFD2

[Back to BioLiP]