Structure of PDB 4qok Chain D Binding Site BS01

Receptor Information
>4qok Chain D (length=194) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIY
SNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVNVAGKSTFGD
GTTLTVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDV
YITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qok Structural basis for ineffective T-cell responses to MHC anchor residue-improved "heteroclitic" peptides.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		G29 Q31
Binding residue
(residue number reindexed from 1)		G28 Q30
External links