Structure of PDB 4qmf Chain D Binding Site BS01

Receptor Information
>4qmf Chain D (length=174) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESSFMTLFPKYRESYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRK
TYDPAIILKARDLIKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKER
FVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVV
EDCMKNIHPIYHIKELMIKRELAK
Ligand information
>4qmf Chain C (length=20) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PEAENLQNDLELQQFLRESH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qmf Interaction between ribosome assembly factors Krr1 and Faf1 is essential for formation of small ribosomal subunit in yeast
Resolution2.804 Å
Binding residue
(original residue number in PDB)		R144 H195 I197 K201
Binding residue
(residue number reindexed from 1)		R107 H158 I160 K164
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:4qmf, PDBe:4qmf, PDBj:4qmf
PDBsum4qmf
PubMed24990943
UniProtP25586|KRR1_YEAST KRR1 small subunit processome component (Gene Name=KRR1)

[Back to BioLiP]