Structure of PDB 4q96 Chain D Binding Site BS01

Receptor Information
>4q96 Chain D (length=128) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKS
NRKLTFLYLANDVIQNSKRKGPEFTREFESVLVDAFSHVAREADEGCKKP
LERLLNIWQERSVYGGEFIQQLKLSMED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4q96 RPRD1A and RPRD1B are human RNA polymerase II C-terminal domain scaffolds for Ser5 dephosphorylation.
Resolution1.85 Å
Binding residue
(original residue number in PDB)
F4 C100 P103 R106
Binding residue
(residue number reindexed from 1)
F1 C97 P100 R103
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4q96, PDBe:4q96, PDBj:4q96
PDBsum4q96
PubMed24997600
UniProtQ9NQG5|RPR1B_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 1B (Gene Name=RPRD1B)

[Back to BioLiP]