Structure of PDB 4prp Chain D Binding Site BS01

Receptor Information
>4prp Chain D (length=200) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYS
AGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQDLGTSGSRLTF
GEGTQLTVNPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDS
DVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Ligand information
>4prp Chain C (length=11) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HPVGQADYFEY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4prp A Molecular Basis for the Interplay between T Cells, Viral Mutants, and Human Leukocyte Antigen Micropolymorphism.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R31 L109 S112 G113 S114
Binding residue
(residue number reindexed from 1)		R29 L91 S94 G95 S96
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4prp, PDBe:4prp, PDBj:4prp
PDBsum4prp
PubMed24759101
UniProtP01848|TRAC_HUMAN T cell receptor alpha chain constant (Gene Name=TRAC)

[Back to BioLiP]