Structure of PDB 4p5h Chain D Binding Site BS01

Receptor Information

>4p5h Chain D (length=286) Species: 1502 (Clostridium perfringens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GAMGSDGLYVIDKGDGWILGEPSVVSSQILNPNETGTFSQSLTKSKEVSI
NVNFSVGFTSEFIQASVEYGFGITIGEQNTIERSVSTTAGPNEYVYYKVY
ATYRKYQAIRISHGNISDDGSIYKLTGIWLSKTSADSLGNIDQGSLIETG
ERCVLTVPSTDIEKEILDLAAATERLNLTDALNSNPAGNLYDWRSSNSYP
WTQKLNLHLTITATGQKYRILASKIVDFNIYSNNFNNLVKLEQSLGDGVK
DHYVDISLDAGQYVLVMKANSSYSGNYPYSILFQKF

Ligand information

>4p5h Chain S (length=9) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

YNPLVPDAM

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4p5h Structure of a C. perfringens Enterotoxin Mutant in Complex with a Modified Claudin-2 Extracellular Loop 2.
Resolution	3.38 Å
Binding residue (original residue number in PDB)	D225 L254 A255 S256 I258 V259 D284 S313 L315
Binding residue (residue number reindexed from 1)	D192 L221 A222 S223 I225 V226 D251 S280 L282

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Cellular Component
GO:0005576	extracellular region

View graph for
Cellular Component

External links

PDB	RCSB:4p5h, PDBe:4p5h, PDBj:4p5h
PDBsum	4p5h
PubMed	25020226
UniProt	P01558\|ELTB_CLOPF Heat-labile enterotoxin B chain (Gene Name=cpe)

[Back to BioLiP]