Structure of PDB 4ozh Chain D Binding Site BS01

Receptor Information

>4ozh Chain D (length=181) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTL
LGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTIS
PSHNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILV
MLEMTPQRGDVYTCHVEHPSLQSPITVEWRA

Ligand information

>4ozh Chain I (length=12) Species: 4565 (Triticum aestivum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

APQPELPYPQPG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4ozh T-cell receptor recognition of HLA-DQ2-gliadin complexes associated with celiac disease.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	F11 S28 P56 A57 Y60 W61 I67 R70 K71 R77 V78 H81 N82 L85
Binding residue (residue number reindexed from 1)	F9 S26 P54 A55 Y58 W59 I65 R68 K69 R75 V76 H79 N80 L83

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4ozh, PDBe:4ozh, PDBj:4ozh
PDBsum	4ozh
PubMed	24777060
UniProt	Q5Y7D3

[Back to BioLiP]