Structure of PDB 4ozg Chain D Binding Site BS01

Receptor Information

>4ozg Chain D (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTL
LGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTIS
PSNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVM
LEMTPQRGDVYTCHVEHPSLQSPITVEWRA

Ligand information

>4ozg Chain I (length=13) Species: 4565 (Triticum aestivum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

APQPELPYPQPGS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4ozg T-cell receptor recognition of HLA-DQ2-gliadin complexes associated with celiac disease.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	F11 L26 S28 A57 Y60 W61 I67 K71 R77 V78 N82
Binding residue (residue number reindexed from 1)	F9 L24 S26 A55 Y58 W59 I65 K69 R75 V76 N80

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4ozg, PDBe:4ozg, PDBj:4ozg
PDBsum	4ozg
PubMed	24777060
UniProt	Q5Y7D3

[Back to BioLiP]