Structure of PDB 4noe Chain D Binding Site BS01

Receptor Information
>4noe Chain D (length=133) Species: 1299 (Deinococcus radiodurans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FTMLQIEFITDLGARVTVNVEHESRLLDVQRHYGRLGWTSGEIPSGGYQF
PIENEADFDWSLIGARKWELVIHRGHAYRRRELEAVLPAAIKYSRGAKVS
DPQHVREKADGDIEYVSLAIFRGGKRQERYAVP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4noe Mechanism for accurate, protein-assisted DNA annealing by Deinococcus radiodurans DdrB.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		R83 R85 L87 L97 P98 K102 S104 G106 A107 A119 I123 Y125
Binding residue
(residue number reindexed from 1)		R79 R81 L83 L87 P88 K92 S94 G96 A97 A109 I113 Y115
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4noe, PDBe:4noe, PDBj:4noe
PDBsum4noe
PubMed27044084
UniProtQ9RY80|DDRB_DEIRA Single-stranded DNA-binding protein DdrB (Gene Name=ddrB)

[Back to BioLiP]