Structure of PDB 4nft Chain D Binding Site BS01

Receptor Information
>4nft Chain D (length=178) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNK
RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSSRSQRAGLQFP
VGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKV
KRITPRHLQLAIRGDEELDSLIKATIAG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4nft Anp32e, a higher eukaryotic histone chaperone directs preferential recognition for H2A.Z
Resolution2.61 Å
Binding residue
(original residue number in PDB)		K26 G29 I30 S33 F34 Q167 R171
Binding residue
(residue number reindexed from 1)		K22 G25 I26 S29 F30 Q159 R163
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4nft, PDBe:4nft, PDBj:4nft
PDBsum4nft
PubMed24613878
UniProtP0C0S5|H2AZ_HUMAN Histone H2A.Z (Gene Name=H2AZ1);
Q16778|H2B2E_HUMAN Histone H2B type 2-E (Gene Name=H2BC21)

[Back to BioLiP]