Structure of PDB 4mte Chain D Binding Site BS01

Receptor Information
>4mte Chain D (length=151) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKTTTQELLAQAEKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLL
REAEPQAKPPTVYRALDFLLEQGFVHKVESTNSYVLCHLFDQPTHTSAMF
ICDRCGAVKEECAEGVEDIMHTLAAKMGFALRHNVIEAHGLCAACVEVEA
C
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4mte Structural and Mechanistic Basis of Zinc Regulation Across the E. coli Zur Regulon.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		T25 Q27 R28 Q57 P61 R65
Binding residue
(residue number reindexed from 1)		T24 Q26 R27 Q56 P60 R64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0042802 identical protein binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:1900376 regulation of secondary metabolite biosynthetic process
Cellular Component
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4mte, PDBe:4mte, PDBj:4mte
PDBsum4mte
PubMed25369000
UniProtP0AC51|ZUR_ECOLI Zinc uptake regulation protein (Gene Name=zur)

[Back to BioLiP]