Structure of PDB 4mnq Chain D Binding Site BS01

Receptor Information
>4mnq Chain D (length=200) Species: 9598,9606 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IQVEQSPPDLILQEGANSTLRCNFSDSVNNLWWFHQNPWGQLINLFYIPS
GTKQNGRLSATTVATERYSLLYISSSQTTDSGVYFCAVDSATALPYGYIF
GTGTRLKVLANIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDS
DVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4mnq T-cell receptor (TCR)-peptide specificity overrides affinity-enhancing TCR-major histocompatibility complex interactions.
Resolution2.742 Å
Binding residue
(original residue number in PDB)
D90 A94 P96 Y97
Binding residue
(residue number reindexed from 1)
D89 A93 P95 Y96
Enzymatic activity
Enzyme Commision number ?
External links