Structure of PDB 4mbe Chain D Binding Site BS01

Receptor Information
>4mbe Chain D (length=149) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREIL
DLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGK
ISIKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS
Ligand information
>4mbe Chain X (length=6) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DKESIV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4mbe Structural basis for binding the TREX2 complex to nuclear pores, GAL1 localisation and mRNA export.
Resolution2.612 Å
Binding residue
(original residue number in PDB)		Q23 Y26
Binding residue
(residue number reindexed from 1)		Q11 Y14
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008017 microtubule binding
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0000226 microtubule cytoskeleton organization
GO:0006406 mRNA export from nucleus
GO:0030474 spindle pole body duplication
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0048193 Golgi vesicle transport
GO:0051301 cell division
Cellular Component
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005737 cytoplasm
GO:0005816 spindle pole body
GO:0005825 half bridge of spindle pole body
GO:0005856 cytoskeleton
GO:0044732 mitotic spindle pole body
GO:0070390 transcription export complex 2

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4mbe, PDBe:4mbe, PDBj:4mbe
PDBsum4mbe
PubMed24705649
UniProtP06704|CDC31_YEAST Cell division control protein 31 (Gene Name=CDC31)

[Back to BioLiP]