Structure of PDB 4lg2 Chain D Binding Site BS01

Receptor Information
>4lg2 Chain D (length=122) Species: 386032 (Reston ebolavirus - Reston (1989)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ISAKDLKEIMYDHLPGFGTAFHQLVQVICKIGKDNNLLDTIHAEFQASLA
DGDSPQCALIQITKRVPIFQDVPPPIIHIRSRGDIPRACQKSLRPAPPSP
KIDRGWVCLFKMQDGKTLGLKI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lg2 Ebolavirus VP35 coats the backbone of double-stranded RNA for interferon antagonism.
Resolution2.7 Å
Binding residue
(original residue number in PDB)
C264 I267 Q268 K271 R311
Binding residue
(residue number reindexed from 1)
C57 I60 Q61 K64 R104
Binding affinityPDBbind-CN: Kd=0.1uM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4lg2, PDBe:4lg2, PDBj:4lg2
PDBsum4lg2
PubMed23824825
UniProtQ8JPY0|VP35_EBORR Polymerase cofactor VP35 (Gene Name=VP35)

[Back to BioLiP]