Structure of PDB 4l1u Chain D Binding Site BS01

Receptor Information
>4l1u Chain D (length=136) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ITHMVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKP
VYRVAEITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFT
ESEFMKWKEAMFSAGMQLPTLDEINKKELSIKEALN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4l1u Structural basis for Spt5-mediated recruitment of the Paf1 complex to chromatin.
Resolution2.424 Å
Binding residue
(original residue number in PDB)		Y400 E440
Binding residue
(residue number reindexed from 1)		Y52 E92
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:4l1u, PDBe:4l1u, PDBj:4l1u
PDBsum4l1u
PubMed24101474
UniProtQ92541|RTF1_HUMAN RNA polymerase-associated protein RTF1 homolog (Gene Name=RTF1)

[Back to BioLiP]