Structure of PDB 4kdp Chain D Binding Site BS01

Receptor Information

>4kdp Chain D (length=151) Species: 176280 (Staphylococcus epidermidis ATCC 12228) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MVRRIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIE
ALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLEKPDSNTDQRLKIIKLS
NKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSK
L

Ligand information

>4kdp Chain J (length=10) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgcgcagccc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4kdp TcaR-ssDNA complex crystal structure reveals new DNA binding mechanism of the MarR family proteins.
Resolution	3.6 Å
Binding residue (original residue number in PDB)	S37 N64 A67 R70
Binding residue (residue number reindexed from 1)	S37 N64 A67 R70

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4kdp, PDBe:4kdp, PDBj:4kdp
PDBsum	4kdp
PubMed	24531929
UniProt	A0A0H2VJZ8

[Back to BioLiP]