Structure of PDB 4jk0 Chain D Binding Site BS01

Receptor Information
>4jk0 Chain D (length=120) Species: 12145 (Tomato bushy stunt virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMTSPFKLPDESPSWTEWRLHNDETNPLGFKESWGFGKVVFKRYLRYDRT
EASLHRVLGSWTGDSVNYAASRFFGFDQIGCQYSIRFRGVSITVSGGSRT
LQHLCEMAIRSKQELLQLAP
Ligand information
>4jk0 Chain B (length=21) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuugcugcugcugcugcugcu
.....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jk0 Procrustean bed of RNA silencing suppression
Resolution2.3 Å
Binding residue
(original residue number in PDB)		S14 P15 W17 W20 L35 K38 Y51 Q85 I86 G87 R93 R95 G96 S102 G103 G104
Binding residue
(residue number reindexed from 1)		S12 P13 W15 W18 L28 K31 Y44 Q78 I79 G80 R86 R88 G89 S95 G96 G97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0044423 virion component

View graph for
Cellular Component
External links
PDB RCSB:4jk0, PDBe:4jk0, PDBj:4jk0
PDBsum4jk0
PubMed
UniProtP69517|P19_TBSVK RNA silencing suppressor p19 (Gene Name=ORF4)

[Back to BioLiP]