Structure of PDB 4jbk Chain D Binding Site BS01

Receptor Information
>4jbk Chain D (length=187) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPKKNISKGAVLHEKPMTVMVLTATEPFNYKEGKENMFHATVATESQYYR
VKVFNMDLKEKFTENKFITISKYFNSSGILEINETATVSEAAPNQMFEVP
KNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNED
NIKVVWDKEQNINQLFSFHLRNGKPILHSGNHSFIKG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jbk Structural basis for termination of AIM2-mediated signaling by p202
Resolution2.963 Å
Binding residue
(original residue number in PDB)		K137 N139 D140 K141 S142 K155
Binding residue
(residue number reindexed from 1)		K135 N137 D138 K139 S140 K153
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002218 activation of innate immune response
GO:0035458 cellular response to interferon-beta

View graph for
Biological Process
External links
PDB RCSB:4jbk, PDBe:4jbk, PDBj:4jbk
PDBsum4jbk
PubMed23567559
UniProtQ9R002|IFI2_MOUSE Interferon-activable protein 202 (Gene Name=Ifi202)

[Back to BioLiP]