Structure of PDB 4j8r Chain D Binding Site BS01

Receptor Information
>4j8r Chain D (length=220) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKLQESGGEVVRPGTSVKVSCKASGYAFTNYLIEWVKQRPGQGLEWIGVI
NPGSGDTNYNEKFKGKATLTADKSSSTAYMQLNSLTSDDSAVYFCARSGA
AAPTYYAMDYWGQGVSVTVSSAKTTPPSVYPLAPAAAAANSMVTLGCLVK
GYFPEPVTVTWNSGSLSGGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETV
TCNVAHPASSTKVDKKIVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4j8r The crystal structure of an octapeptide repeat of the Prion protein in complex with a Fab fragment of the POM2 antibody.
Resolution2.303 Å
Binding residue
(original residue number in PDB)		Y32 N58 G96 A97 P100 T100A Y100B Y100C A100D D101
Binding residue
(residue number reindexed from 1)		Y31 N58 G99 A100 P103 T104 Y105 Y106 A107 D109
External links