Structure of PDB 4j1g Chain D Binding Site BS01

Receptor Information
>4j1g Chain D (length=227) Species: 999729 (Leanyer virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DFIYDDRPAAVSSTFNPEKGYMDFITAYGKNINADNVRIFFLNHKKAKDS
LKGSPKVEVDLQFGTLRVKVVNNHNPRNRDNPVADNAITLHRLSGYLAKW
CFDEIDHGQIEEAEVKSKVVIPLAEAKGCKWGDGVALYLAFAPGAEMFLK
DFEFYPLAIDIQRVVKDGMDITFMRKVLKQRYGTKTADDWMISEVTAIQS
AVKVVAKLPWAKAGFTAAAKNFLAKFN
Ligand information
>4j1g Chain E (length=45) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuu
.............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4j1g Structure of the Leanyer orthobunyavirus nucleoprotein-RNA complex reveals unique architecture for RNA encapsidation.
Resolution2.789 Å
Binding residue
(original residue number in PDB)		S18 F20 N21 P22 L47 H49 K53 N78 H79 V88 R97 P127 L128 E130 R168 F178 R180 K181 K184 Q185 R186
Binding residue
(residue number reindexed from 1)		S13 F15 N16 P17 L42 H44 K48 N73 H74 V83 R92 P122 L123 E125 R163 F173 R175 K176 K179 Q180 R181
Binding affinityPDBbind-CN: Kd=0.166uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0019013 viral nucleocapsid
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4j1g, PDBe:4j1g, PDBj:4j1g
PDBsum4j1g
PubMed23569220
UniProtF2WAD7

[Back to BioLiP]