Structure of PDB 4inh Chain D Binding Site BS01

Receptor Information

>4inh Chain D (length=167) Species: 524364 (Norovirus Hu/1968/US) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DKAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIA
IHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLA
VRMGAIASMRIQGRLVHGQSGMLLTGGTIPGDCGAPYVHKRGNDWVVCGV
HAAATKSGNTVVCAVQA

Ligand information

>4inh Chain T (length=4) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tALQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4inh Structural basis of substrate specificity and protease inhibition in norwalk virus.
Resolution	1.7 Å
Binding residue (original residue number in PDB)	H30 Q110 T134 P136 C139 A158 A159 A160 V168
Binding residue (residue number reindexed from 1)	H32 Q112 T128 P130 C133 A152 A153 A154 V162

Enzymatic activity

Enzyme Commision number

2.7.7.48: RNA-directed RNA polymerase.
3.4.22.66: calicivirin.
3.6.1.15: nucleoside-triphosphate phosphatase.

Gene Ontology

	Molecular Function
GO:0004197	cysteine-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4inh, PDBe:4inh, PDBj:4inh
PDBsum	4inh
PubMed	23365454
UniProt	Q83883\|POLG_NVN68 Genome polyprotein (Gene Name=ORF1)

[Back to BioLiP]